PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G010408.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family HRT-like
Protein Properties Length: 402aa    MW: 44739.1 Da    PI: 10.1579
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G010408.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like53.83.1e-17272302131
              HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                           iCGv l++ s+C+r+Pv+gRKRC+ HKGmRi
  HL.SW.v1.0.G010408.1 272 ICGVVLGHDSICRRPPVEGRKRCADHKGMRI 302
                           8*****************************7 PP

2HRT-like54.52e-17350380131
              HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                           +CG+il dGs+C+ qP+kg+KRC eHKG+Ri
  HL.SW.v1.0.G010408.1 350 TCGFILVDGSPCRSQPIKGNKRCVEHKGKRI 380
                           7*****************************7 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MVAGEPGAVV PRLKREDCKH TKHDRQFSRW EILVGPSDWE DYSLGKEGAE RYRVHNLPKD  60
SGPGVYELGI AVSRTGLGRE IGKLVPERIV VVYLGQADSV RTRLQRYGRS GAHLGNSYSS  120
GIPTDSKAAL QKGPGLFEEI LLSGYPIVFR WAPMPSKSDA IRTETKLLNT FDYAWNTSIN  180
GSRRPNDIIQ KLKKISLSTT CFYDGVLRLV PFSQKQVGIR IEARKLPSTE NKFSSHVEDE  240
NHNLLSRVFK FGRSQPRLVL DRSTITEDRT TICGVVLGHD SICRRPPVEG RKRCADHKGM  300
RIKGAVKVEI SNSNVHPQSD CAAPRSSHDD SKGLSQVTVN YLTSERFTPT CGFILVDGSP  360
CRSQPIKGNK RCVEHKGKRI HKPNSVPVQN GKIDYLQLVI S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010090025.10.0hypothetical protein L484_027255
TrEMBLW9R5X10.0W9R5X1_9R
STRINGVIT_11s0016g02440.t011e-130(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF94093139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.14e-87effector of transcription2